PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc04574.1.g00030.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 590aa    MW: 64372.9 Da    PI: 8.0572
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc04574.1.g00030.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.86e-2154109156
                                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   +++ +++t+ q++ Le++F+++++p++++r +L+++lgL+ rq+k+WFqNrR+++k
  Zpz_sc04574.1.g00030.1.am.mk  54 KKRYHRHTPRQIQMLEAMFKECPHPDENQRMQLSRELGLEPRQIKFWFQNRRTQMK 109
                                   678899***********************************************998 PP

2START75.11.8e-2419329771164
                                   CT-TT-S....EEEEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-T CS
                         START  71 qWdetla....kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.ss 140
                                   +W e ++    ka t++v+ +g     + l+lm+ el ++sp+vp R+f f+Ry+rq + g w+i+d+Svd +q  p   +
  Zpz_sc04574.1.g00030.1.am.mk 193 KWMEFFPaivsKARTIDVLVNGmagrsESLVLMYEELHVMSPVVPtREFCFLRYCRQIEHGLWAIADISVDLPQRDPRfGA 273
                                   78888888888********************************************************************** PP

                                   TSEE-EESSEEEEEEEECTCEEEE CS
                         START 141 svvRaellpSgiliepksnghskv 164
                                   +  R+ +lpSg+li +++ng skv
  Zpz_sc04574.1.g00030.1.am.mk 274 PPPRSARLPSGCLIADMANGSSKV 297
                                   *********************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.42E-2140111IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-2248116IPR009057Homeodomain-like
PROSITE profilePS5007118.04251111IPR001356Homeobox domain
SMARTSM003896.9E-2052115IPR001356Homeobox domain
CDDcd000861.17E-1953112No hitNo description
PfamPF000461.7E-1854109IPR001356Homeobox domain
PROSITE patternPS00027086109IPR017970Homeobox, conserved site
PROSITE profilePS5084820.707181297IPR002913START domain
SuperFamilySSF559619.61E-16192297No hitNo description
PfamPF018524.5E-20192297IPR002913START domain
SuperFamilySSF559611.31E-19343550No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MSHSPLSSFP SVRRIALEAT GRPPRSTAEV CVRARAAMDF GDDVMEGSDS QRRKKRYHRH  60
TPRQIQMLEA MFKECPHPDE NQRMQLSREL GLEPRQIKFW FQNRRTQMKA QHERADNCFL  120
RAENDKIRCE NIAMREALRN VICPTCGGPH LPPVQPVSMS SLELSVGGLG SPAALGPSLD  180
LDLLSGASSG LAKWMEFFPA IVSKARTIDV LVNGMAGRSE SLVLMYEELH VMSPVVPTRE  240
FCFLRYCRQI EHGLWAIADI SVDLPQRDPR FGAPPPRSAR LPSGCLIADM ANGSSKVPNL  300
SITTHVPFFY SYVRVHCRRA CERYACLVTA GMPNREIAGV TLEGKRSMMK LSQRMVSSFC  360
ASLSASQLHR WTTLSGPNDV GVRVMVHRST DPGQPSGVVL SAATSIWLPV PCERVFAFVR  420
DENTRSQWDV LSHGNPVQEV SRIPNGTQPG NCISLLRGLN ASQNSMLILQ ESCTDASGSL  480
VVYAPIDIPA ANVVMSGEDP SAIPLLPSGF TILPDGRPGA STSSGPSAGG SLVTVAFQIL  540
VSSLPSSKLN AESPLMSSPT RPLDRIECAP CDAYASLRPI LPDSCLAAEE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7285230.0KJ728523.1 Zea mays clone pUT6828 HB transcription factor (HB83) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001142912.20.0uncharacterized protein LOC100275344
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLG2J5S70.0G2J5S7_MAIZE; HB transcription factor
STRINGGRMZM2G126646_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.11e-111homeodomain GLABROUS 11